PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01427.1.g00190.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 590aa    MW: 63954.9 Da    PI: 10.4663
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01427.1.g00190.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.94.1e-21371414245
                                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                        SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 
                                   + en+s rq+t+skRr gilKKA+ELS+LCd++  +++fs+tgk
  Zpz_sc01427.1.g00190.1.am.mk 371 KLENSSGRQITYSKRRSGILKKAKELSILCDIDLILLMFSPTGK 414
                                   679***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.44E-21362422IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.474362414IPR002100Transcription factor, MADS-box
SMARTSM004323.8E-29362421IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-17364384IPR002100Transcription factor, MADS-box
PfamPF003191.4E-18372415IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-17384399IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-17399420IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
LFGPTRSSNL KSAPRSSPAS FRARSWRCAM YEASALVTAC TTQAERHAAR RRAAAARRRP  60
SGKRCGGGGS MVEVGLHPPV PWVLVCGVAG TYWGPGQREL LSWPVDGGWL RAIDGADAKQ  120
RSGRDEQRRA FGGGGGARAG LPDVSRVPGT TQQGHTDYQQ APSATQVAFE SAGAACRERS  180
FLVTLILMHN SGSRSIWLPA LCAAGDVWNR YVSQRRHGSV LCHGAARLRL VTLWHHLPSE  240
PFSFPPARFS LYLLSARLFL SPRPRLSRPK NSAGFAGTWP DLPHPPSLPP SLALSPLLPS  300
GSRSAPLNRS TDGKLVGAFR VSVVARSPAL APRRVCVSSP PETGSSVGRG NRTPSVWLFS  360
AMGRVKLKIK KLENSSGRQI TYSKRRSGIL KKAKELSILC DIDLILLMFS PTGKPTICIG  420
DKRKLESLEE NVAKQHLIGL QCAAAQFQND MQLPLGLTGE PNVSQWFHSG SIDMQQPVML  480
PDDPSLLHQR DIGCSTGTSL QSYPGYFSMS KHSTDTGGGS EHGQPSLQQT PPPDFSHADC  540
LTSLHLGAQF PYTPFDHTSL LNERMFRPDV VELHDGVVYP GPSQHQQVMI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.17e-19AGAMOUS-like 30